<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
Fj052 Fj052 China 2004 HIV1 CRF01_AE PBMC None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, K20R, M36I, R41K, L63P, H69K, L89M, I93L P9L
>Fj052| codons 1-99
PQITLWQRLLVTVKIGGQLREALLDTGADDTVLEEINLPGKWKPKMIGGIGGFIKVRQYD
QIPIEICGKKAIGTVLVGPTPVNIIGRNMLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        E6D, K32R, V35T, T39K, K43D, F77S, V90I, K122E, D123S, K173I, Q174K, D177E, V189A, Q207A, R211S, K238R, I244V, V245E, A272P, T286A, E291D, V292I, I293V, E312T, I326V, I329V, Q334E, M357K, R358G, G359S, K366R, A371V, K390R, K395R, A400I, T403M, V435E, N447H, V466A, D471E, Q480H, L491S, K512R, L517I, S519N, Q524E, A534S, A554S  
>Fj052| codons 1-560
PISPIDTVPVKLKPGMDGPKVKQWPLTEEKIRALTEICKEMEDEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDSRELNKRTQDFWEIQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DESFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRIKNPEIVI
YQYMDDLYAGSDLEIGQHRTKIEELRAHLLSWGFTTPDKKHQKEPPFLWMGYELHPDRWT
VQPVELPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGAKALTDIVPLTEEAE
LELAENREILKTPVHGVYYDPSKDLVAEVQKQGEGQWTYQIYQEPFKNLKTGKYARKGSA
HTNDVRQLTEVVQKIATESIVIWGKTPKFRLPIQRETWEIWWMEYWQATWIPEWEFVNTP
PLVKLWYQLEKEPIEGAETFYVDGAAHRETKLGKAGYVTDRGRQKAVSLTETTNQKTELH
AIHLALQDSGSEVNIVTDSQYALGIIQAQPDRSESEIVNQIIEELIKKEKVYLSWVPAHK
GIGGNEQVDKLVSSGIRKVL

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
    V31I, S39N, I72V, T112V, T124A, T125A, G134D, I135V, K136R, K160N, I162V, D167E, V201I, I220V, L234I, K240R S283G
>Fj052| codons 1-288
FLDGIDKAQEEHEKYHSNWRAMASDFNLPPIVAKEIVANCDKCQLKGEAMHGQVDCSPGI
WQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKVIHTDNGSN
FTSAAVKAACWWADVRQEFGIPYNPQSQGVVESMNKELKNIVGQVREQAEHLKTAVQMAV
FIHNFKRKGGIGGYSAGERIIDIIATDIQTKELQKQITKVQNFRVYYRDSRDPIWKGPAR
LLWKGEGAVVIQDNSDIKVVPRRKAKIIRDYGKQMAGDDCVAGRQDED

References
Author Title Citation
Hai-Long, H Genetic characterization of CRF01_AE full-length human immunodeficiency virus type 1 sequences from Fujian, China. ARHR, 2007