<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
Fj055 Fj055 China 2004 HIV1 CRF01_AE PBMC None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, E35D, M36I, R41K, K55R, L63P, H69K, I72V, L89M R8Q
>Fj055| codons 1-99
PQITLWQQPLVTVKIGGQLKEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIRVRQYD
QIPIEICGKKAVGTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        E6D, K11A, V35T, T39K, K43E, K122E, D123N, I135T, K173I, Q174K, D177E, Q207K, R211S, K238R, V245E, I274V, T286V, E291D, I293V, E312T, I326V, I329V, G335D, M357K, G359S, K366R, T369A, A371V, K390R, K395R, A400T, T419A, L425*, E432D, L469P, D471E, Q480R, L491S, K512R, L517V, S519N, Q524E, A534S, A554S V60A, V365A
>Fj055| codons 1-560
PISPIDTVPVALKPGMDGPKVKQWPLTEEKIKALTEICKEMEEEGKISKIGPENPYNTPA
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DENFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRIKNPEIVI
YQYMDDLYVGSDLEIGQHRTKIEELRKHLLSWGFTTPDKKHQKEPPFLWMGYELHPDRWT
VQPIELPEKDSWTVNDIQKLVGKLNWASQIYAGVKVKQLCKLLRGVKALTDVVPLTEEAE
LELAENREILKTPVHGVYYDPSKDLVAEVQKQGQDQWTYQIYQEPFKNLKTGKYARKRSA
HTNDARQLAEVVQKIATESIVIWGKTPKFRLPIQRETWETWWTEYWQATWIPEWEFVNAP
PLVK*WYQLEKDPIVGAETFYVDGAANRETKLGKAGYVTDRGRQKVVSPTETTNQKTELR
AIHLALQDSGSEVNIVTDSQYALGIIQAQPDRSESEVVNQIIEELIKKEKVYLSWVPAHK
GIGGNEQVDKLVSSGIRKVL

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
    K14R, A21T, V31I, I72V, T112V, T124A, T125A, G134N, I135V, K136R, V165I, D167E, V201I, L234I C40S, A105T, S283G
>Fj055| codons 1-288
FLDGIDKAQEEHERYHSNWRTMASDFNLPPIVAKEIVASSDKCQLKGEAMHGQVDCSPGI
WQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLTGRWPVKVIHTDNGSN
FTSAAVKAACWWANVRQEFGIPYNPQSQGVVESMNKELKKIIGQIREQAEHLKTAVQMAV
FIHNFKRKGGIGGYSAGERIIDIIATDIQTKELQKQITKIQNFRVYYRDSRDPIWKGPAK
LLWKGEGAVVIQDNSDIKVVPRRKAKIIRDYGKQMAGDDCVAGRQDED

References
Author Title Citation
Hai-Long, H Genetic characterization of CRF01_AE full-length human immunodeficiency virus type 1 sequences from Fujian, China. ARHR, 2007