<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
pWCML249 pWCML249 Kenya 1997 HIV1 D PBMC BC

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L19I, R41K, L63P  
>pWCML249| codons 1-99
PQITLWQRPLVTIKIGGQIKEALLDTGADDTVLEEMNLPGKWKPKMIGGIGGFIKVRQYD
QIPIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        P4H, V35T, E40D, K49R, V60I, D121Y, K122E, T139A, A158S, D177E, I178L, T200I, Q207G, R211K, V245E, D250E, A272P, K277R, L282C, L283I, T286A, A288T, I293V, P321Q, E328D, G335D, P345Q, F346Y, A355T, R356K, M357L, A360T, E370A, T377Q, S379C, K390R, A400T, H483N, A534S, A554N, I556V, V559I L310P
>pWCML249| codons 1-560
PISHIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTDMEKEGKISRIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
YEDFRKYTAFTIPSINNEAPGIRYQYNVLPQGWKGSPSIFQSSMTKILEPFRKQNPELVI
YQYMDDLYVGSDLEIGQHRIKIEELRGHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIELPEKESWTVNDIQKLVGKLNWASQIYPGIKVRQLCKCIRGAKTLTEVVPLTEEAE
LELAENREIPKEPVHGVYYDQSKDLIADIQKQGQDQWTYQIYQEQYKNLKTGKYTKLRGT
HTNDVKQLTAAVQKIAQECIVIWGKTPKFRLPIQKETWETWWTEYWQATWIPEWEFVNTP
PLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTDRGRQKVVSLTDTTNQKTELQ
AINLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVSQIIEQLIKKEKVYLSWVPAHK
GIGGNEQVDKLVSNGVRKIL

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
    S17N, L45I, M50I, I73T, T112V, I113V, T124A, T125A, V201I, T218I, L234I, D256E, A265V  
>pWCML249| codons 1-288
FLDGIDKAQEEHEKYHNNWRAMASDFNLPPVVAKEIVASCDKCQIKGEAIHGQVDCSPGI
WQLDCTHLEGKITLVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKVVHTDNGSN
FTSAAVKAACWWAGIKQEFGIPYNPQSQGVVESMNKELKKIIGQVRDQAEHLKTAVQMAV
FIHNFKRKGGIGGYSAGERIIDIIATDIQTKELQKQIIKIQNFRVYYRDSRDPIWKGPAK
LLWKGEGAVVIQDNSEIKVVPRRKVKIIRDYGKQMAGDDCVASRQDED

References
Author Title Citation
Shi, B Construction of an infectious HIV type 1 molecular clone from an African patient with a subtype D/C recombinant virus. ARHR, 2004