<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
1579A 1579A India 2001 HIV1 C PBMC BC

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, E35D, M36I, N37D, P39S, R41K, R57K, I62V, H69K, K70R, L89M  
>1579A| codons 1-99
PQITLWQRPLVTVKIGGQLKEALLDTGADDTVLEDIDLSGKWKPKMIGGIGGFIKVKQYD
QVLIEICGKRAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35T, T39E, S48T, V60I, I135V, S162N, K173A, D177E, I195T, Q197K, T200A, Q207E, E224G, V245Q, A272P, K277R, K281R, T286A, E291D, V292I, I293V, V317A, D324E, Q334H, G335D, R356K, G359T, T369A, T377M, K390R, A400T, E404D, V435A, V466I, D471E, T473P, H483Y, L491S, T497P, S519N, A534S, A554S  
>1579A| codons 1-560
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICEEMEKEGKITKIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQNSMTKILEPFRAQNPEIVI
YQYMDDLYVGSDLETGKHRAKIEELREHLLRWGFTTPDKKHQKGPPFLWMGYELHPDKWT
VQPIQLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCRLLRGAKALTDIVPLTEEAE
LELAENREILKEPVHGAYYDPSKELIAEIQKQGHDQWTYQIYQEPFKNLKTGKYAKMRTA
HTNDVKQLAEAVQKIAMESIVIWGKTPKFRLPIQKETWETWWTDYWQATWIPEWEFVNTP
PLVKLWYQLEKEPIAGAETFYVDGAANRETKLGKAGYVTDRGRQKIVSLTETPNQKTELQ
AIYLALQDSGSEVNIVPDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLSWVPAHK
GIGGNEQVDKLVSSGIRKVL

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
  L74M V31I, M50I, I72V, P90Q, L101I, T112V, I113V, T124A, T125A, K136Q, D167E, V201I, I203M, K219R S283G
>1579A| codons 1-288
FLDGIDKAQEEHEKYHSNWRAMASDFNLPPIVAKEIVASCDKCQLKGEAIHGQVDCSPGI
WQLDCTHLEGKVIMVAVHVASGYIEAEVIQAETGQETAYFILKLAGRWPVKVVHTDNGSN
FTSAAVKAACWWAGIQQEFGIPYNPQSQGVVESMNKELKKIIGQVREQAEHLKTAVQMAV
FIHNFKRKGGIGGYSAGERIIDMIATDIQTKELQKQITRIQNFRVYYRDSRDPLWKGPAK
LLWKGEGAVVIQDNSDIKVVPRRKAKIIRDYGKQMAGDDCVAGRQDED

References
Author Title Citation
Rodriguez, MA Construction and characterization of an infectious molecular clone of HIV-1 subtype A of Indian origin. Virology, 2006