<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
FJ054 FJ054 China 2006 HIV1 CRF01_AE PBMC Genomic

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, G16E, K20R, E35D, M36I, R41K, I62V, H69K, L89M  
>FJ054| codons 1-99
PQITLWQRPLVTVKIEGQLREALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVRQYD
QVLIEICGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        E6D, V35T, T39K, K43E, K122E, D123S, I135L, K166R, R172K, K173I, Q174K, D177E, G196E, T200A, Q207A, L210F, R211S, V245E, E248D, A272P, I274V, E291D, V292I, I293V, E312T, I329V, G335D, M357K, G359S, K366R, A371V, K390R, K395R, A400T, E432D, N447S, D460N, D471E, Q480H, H483Y, L491S, K512R, S513N, L517I, S519N, Q524E, L525I, Y532H, A534S, V548I, A554S P19S, K30R
>FJ054| codons 1-560
PISPIDTVPVKLKPGMDGSKVKQWPLTEERIKALTEICKEMEEEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DESFRKYTAFTIPSLNNETPGIRYQYNVLPQGWKGSPAIFQSSMTRILEPFKIKNPEIVI
YQYMDDLYVGSDLEIEQHRAKIEELRAHLFSWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIELPDKDSWTVNDIQKLVGKLNWASQIYPGVKVKQLCKLLRGTKALTDIVPLTEEAE
LELAENREILKTPVHGVYYDPSKDLIAEVQKQGQDQWTYQIYQEPFKNLKTGKYARKRSA
HTNDVRQLTEVVQKIATESIVIWGKTPKFRLPIQRETWETWWTEYWQATWIPEWEFVNTP
PLVKLWYQLEKDPIVGAETFYVDGAASRETKLGKAGYVTNRGRQKVVSLTETTNQKTELH
AIYLALQDSGSEVNIVTDSQYALGIIQAQPDRNESEIVNQIIEEIIKKEKVHLSWVPAHK
GIGGNEQIDKLVSSGIRKVL

References
Author Title Citation
Huang, HL Genetic characterization of three CRF01_AE full-length HIV type 1 sequences from Fujian province, China. Chin Med J (Engl), 2006