<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
TZBFL0088 TZBFL0088 Tanzania 1996 HIV1 D PBMC MC

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, K14R, M36I, P39A, R41K, I64V, V77I  
>TZBFL0088| codons 1-99
PQITLWQRPLVTVRIGGQLKEALLDTGADDTVLEEINLAGKWKPKMIGGIGGFIKVRQYD
QILVEICGHKAIGTVLIGPTPVNIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        E28K, K32E, V35I, K49R, V60I, D121Y, K122E, I135T, I142L, E169D, D177E, I178L, T200I, Q207E, R211K, F214L, P243T, V245E, D250E, A272P, I274X, K275Q, L282C, L283I, T286A, I293V, I326V, G335D, P345Q, F346Y, A355T, R356K, M357V, A360T, T377Q, E378G, K390R, K395*, A400T, E404D, H483N, L517I, S519N, A534S, A554N, V559I  
>TZBFL0088| codons 1-560
PISPIETVPVKLKPGMDGPKVKQWPLTKEKIEALIEICTEMEKEGKISRIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
YEDFRKYTAFTIPSTNNETPGLRYQYNVLPQGWKGSPAIFQSSMTKILDPFRKQNPELVI
YQYMDDLYVGSDLEIGQHRIKIEELREHLLKWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQTIELPEKESWTVNDIQKLVGKLNWASQIYPGXQVKQLCKCIRGAKALTEVVPLTEEAE
LELAENREILKEPVHGVYYDPSKDLVAEIQKQGQDQWTYQIYQEQYKNLKTGKYTKVRGT
HTNDVKQLTEAVQKIAQGSIVIWGKTPKFRLPIQ*ETWETWWTDYWQATWIPEWEFVNTP
PLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTDRGRQKVVSLTDTTNQKTELQ
AINLALQDSGLEVNIVTDSQYALGIIQAQPDKSESEIVNQIIEQLIKKEKVYLSWVPAHK
GIGGNEQVDKLVSNGIRKIL

References
Author Title Citation
Koulinska, IN Common genetic arrangements among human immunodeficiency virus type 1 subtype A and D recombinant genomes vertically transmitted in Tanzania. ARHR, 2002