<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
BREPM107 BREPM107 Brazil 1999 HIV1 F PBMC None

Treatment History
Order Regimen Weeks
1 RTI|PI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I84V, L90M   I13V, I15V, K20T, E35D, M36I, R41K, R57K, Q61N, L63P, A71V  
>BREPM107| codons 1-99
PQITLWQRPLVTVKVGGQLTEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVKQYD
NIPIEICGHKVIGTVLVGPTPVNVIGRNLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, K70R, M184V, T215F K219Q     D123E, I135T, I167V, G196E, T200I, I202V, R211T, A272P, K281R, E297K, L301I, M357T, G359T, K366R, A400T, K431T, A446S, L452I, R461K, V466A, D471E, T477A, H483Q, L491S, E516D, S519N, K527N, K530R, A534S  
>BREPM107| codons 1-560
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEKEGKISKIGPENPYNTPV
FAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKVLEPFRKQNPDIVI
YQYVDDLYVGSDLEIEQHRIKVEELRQHLLTWGFFTPDQKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCRLLRGTKALTEVIPLTKEAE
IELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARTRTA
HTNDVRQLTEAVQKIATESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTP
PLVKLWYQLETEPIVGAETFYVDGASNRETKIGKAGYVTDKGRQKAVSLTETTNQKAELQ
AIQLALQDSGSEVNIVTDSQYALGIIQAQPDKSESDLVNQIIEQLINKERVYLSWVPAHK
GIGGNEQVDKLVSAGIRKVL

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
    S17N, V32I, S57N, I60M, I72V, S119T, M154I, V165I, V201I, T206S, L234V, D256E V281M, S283G
>BREPM107| codons 1-288
FLDGIDKAQEEHEKYHNNWRAMASDFNLPPVIAKEIVASCDKCQLKGEAMHGQVDCNPGM
WQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTIHTDNGTN
FTSTTVKAACWWAGIKQEFGIPYNPQSQGVVESINKELKKIIGQIRDQAEHLKTAVQMAV
FIHNFKRKGGIGGYSAGERIIDIIASDIQTKELQKQITKIQNFRVYYRDSRDPVWKGPAK
LLWKGEGAVVIQDNSEIKVVPRRKAKIIRDYGKQMAGDDCMAGRQDED

References
Author Title Citation
de Sa Filho, DJ Analysis of full-length human immunodeficiency virus type 1 genome reveals a variable spectrum of subtypes B and f recombinants in Sao Paulo, Brazil. ARHR, 2005