<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
04BR073 04BR073 Brazil 2004 HIV1 C PBMC None

Treatment History
Order Regimen Weeks
1 PI + RTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12S, I13V, I15V, L19I, M36I, N37K, R41N, L63P, I64M, H69K, L89M, I93L  
>04BR073| codons 1-99
PQITLWQRPLVSVKVGGQIKEALLDTGADDTVLEEIKLPGNWKPKMIGGIGGFIKVRQYD
QIPMEICGKKAIGTVLVGPTPVNIIGRNMLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35T, T39D, E40D, S48T, V60I, K122E, D123S, E138A, K173A, P176Q, D177G, T200A, Q207A, R211K, V245Q, A272P, K277R, T286A, E291D, V292I, I293V, G335D, R356K, G359T, K366R, T377Q, K390R, E404D, I434M, V435A, A437V, L452M, D471E, H483L, L484I, L491S, L517I, S519N, K527N, K530R, A534S, A554T  
>04BR073| codons 1-560
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICDDMEKEGKITKIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DESFRKYTAFTIPSINNATPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRAQNQGIVI
YQYMDDLYVGSDLEIGQHRAKIEELRAHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGAKALTDIVPLTEEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGQDQWTYQIYQEPFKNLKTGKYAKMRTA
HTNDVRQLTEAVQKIAQESIVIWGKTPKFRLPIQKETWEAWWTDYWQATWIPEWEFVNTP
PLVKLWYQLEKEPMAGVETFYVDGAANRETKMGKAGYVTDRGRQKVVSLTETTNQKTELQ
AILIALQDSGSEVNIVTDSQYALGIIQAQPDKSESEIVNQIIEQLINKERVYLSWVPAHK
GIGGNEQVDKLVSTGIRKVL

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
    D25E, V31I, M50T, L101I, T112V, T124N, K136Q, V201I, T218I, L234I, I251L, A265V, R269K, D278A V281M
>04BR073| codons 1-288
FLDGIDKAQEEHEKYHSNWRAMASEFNLPPIVAKEIVASCDKCQLKGEATHGQVDCSPGI
WQLDCTHLEGKIILVAVHVASGYIEAEVIPAETGQETAYFILKLAGRWPVKVIHTDNGSN
FTSNTVKAACWWAGIQQEFGIPYNPQSQGVVESMNKELKKIIGQVRDQAEHLKTAVQMAV
FIHNFKRKGGIGGYSAGERIIDIIATDIQTKELQKQIIKIQNFRVYYRDSRDPIWKGPAK
LLWKGEGAVVLQDNSDIKVVPRRKVKIIKDYGKQMAGADCMASRQDED

References
Author Title Citation
Sanabani, S Full-length genome analysis of human immunodeficiency virus type 1 subtype C in Brazil. ARHR, 2006