<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
04BR013 04BR013 Brazil 2004 HIV1 C PBMC None

Treatment History
Order Regimen Weeks
1 PI + RTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, G48V, V82A L24I L10I, K20R, M36I, N37E, R41K, K55R, I62V, L63P, H69K, T74A, L89M, I93L  
>04BR013| codons 1-99
PQITLWQRPIVTIKIGGQLREALIDTGADDTVLEEIELPGKWKPKIIVGIGGFIRVRQYD
QVPIEICGKKAIGAVLVGPTPANIIGRNMLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R T215I, K219Q     V35T, T39D, V60I, T69N, K103Q, K122E, D123S, I135K, K173A, Q174K, D177E, T200A, Q207E, R211K, V245Q, A272P, K277R, E291D, V292I, I293V, Q334E, G335D, R356K, G359T, K366R, T377Q, K390R, E404D, V435P, D460N, V466I, D471E, H483K, L491S, S519N, K530R, A534S, Q547K, A554S  
>04BR013| codons 1-560
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICDEMEKEGKISKIGPENPYNTPI
FAIKKKNSNRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKQKSVTVLDVGDAYFSVPL
DESFRKYTAFTIPSKNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRAKNPEIVI
YQYMDDLYVGSDLEIGQHRAKIEELREHLLKWGFITPDQKHQKEPPFLWMGYELHPDKWT
VQPIQLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTDIVPLTEEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGEDQWTYQIYQEPFKNLKTGKYAKMRTA
HTNDVRQLTEAVQKIAQESIVIWGKTPKFRLPIQKETWEAWWTDYWQATWIPEWEFVNTP
PLVKLWYQLEKEPIPGAETFYVDGAANRETKLGKAGYVTNRGRQKIVSLTETTNQKTELQ
AIKLALQDSGSEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKERVYLSWVPAHK
GIGGNEKVDKLVSSGIRKVL

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
    D25E, V31I, L101I, T112V, T124N, K136Q, V201I, T218I, L234I, I251L, A265V, R269K, D278A D286N
>04BR013| codons 1-288
FLDGIDKAQEEHEKYHSNWRAMASEFNLPPIVAKEIVASCDKCQLKGEAMHGQVDCSPGI
WQLDCTHLEGKIILVAVHVASGYIEAEVIPAETGQETAYFILKLAGRWPVKVIHTDNGSN
FTSNTVKAACWWAGIQQEFGIPYNPQSQGVVESMNKELKKIIGQVRDQAEHLKTAVQMAV
FIHNFKRKGGIGGYSAGERIIDIIATDIQTKELQKQIIKIQNFRVYYRDSRDPIWKGPAK
LLWKGEGAVVLQDNSDIKVVPRRKVKIIKDYGKQMAGADCVASRQNED

References
Author Title Citation
Sanabani, S Full-length genome analysis of human immunodeficiency virus type 1 subtype C in Brazil. ARHR, 2006