<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
101BA 101BA Cameroon 2003 HIV1 F PBMC None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, L19I, K20I, E35D, M36I, R41K, I64M, C67S, H69K, V82I, L89M  
>101BA| codons 1-99
PQITLWQRPLVTVKIGGQIIEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVRQYD
QILMEISGKKAIGTVLVGPTPINIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35T, T39N, E40D, K49R, V60I, K104R, D123E, I135T, T139A, P170T, K173A, D177E, Q207E, R211K, V245N, E248D, A272P, T286A, E291D, V292I, I293V, E297A, E312D, F346Y, R356K, M357R, R358G, G359S, A376C, K390R, A400T, E404D, E413D, E432D, V435I, D471E, Q480H, H483Y, L491S, K512N, L517I, S519N, A534S, A554S  
>101BA| codons 1-560
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICNDMEKEGKISRIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKRSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSTNNEAPGIRYQYNVLPQGWKGSPAIFQSSMTKILETFRAQNPEIVI
YQYMDDLYVGSDLEIGQHRTKIEELREHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPINLPDKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGAKALTDIVPLTAEAE
LELAENREILKDPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPYKNLKTGKYAKRGSA
HTNDVKQLTEAVQKICTESIVIWGKTPKFRLPIQKETWETWWTDYWQATWIPDWEFVNTP
PLVKLWYQLEKDPIIGAETFYVDGAANRETKLGKAGYVTDRGRQKVVSLTETTNQKTELH
AIYLALQDSGSEVNIVTDSQYALGIIQAQPDNSESEIVNQIIEQLIKKEKVYLSWVPAHK
GIGGNEQVDKLVSSGIRKVL

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
    K14R, V31I, M50L, T112V, S119P, T122I, T124A, T125A, D167E, V201I, T206S, T218I, L234I, D256E V281M, S283G
>101BA| codons 1-288
FLDGIDKAQEEHERYHSNWRAMASDFNLPPIVAKEIVASCDKCQLKGEALHGQVDCSPGI
WQLDCTHLEGKIILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKVIHTDNGPN
FISAAVKAACWWAGIKQEFGIPYNPQSQGVVESMNKELKKIIGQVREQAEHLKTAVQMAV
FIHNFKRKGGIGGYSAGERIIDIIASDIQTKELQKQIIKIQNFRVYYRDSRDPIWKGPAK
LLWKGEGAVVIQDNSEIKVVPRRKAKIIRDYGKQMAGDDCMAGRQDED

References
Author Title Citation
Carr, JK High genetic complexity of HIV-1 in low-prevalence, rural regions of Cameroon. Direct Genbank Submission, 2006