<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CH12 CH12 Chile 2001 HIV1 F PBMC None

Treatment History
Order Regimen Weeks
1 RTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10V, T12Q, I15V, E35D, M36I, N37E, R41K, R57K, D60E, Q61D  
>CH12| codons 1-99
PQITLWQRPVVQIKVGGQLKEALLDTGADDTVLEDIELPGKWKPKMIGGIGGFIKVKQYE
DILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Sierra, M The analysis of near full-length genome sequences of human immunodeficiency virus type 1 BF intersubtype recombinant viruses from Chile, Venezuela and Spain reveals their relationship to diverse lineages of recombinant viruses related to CRF12_BF. Infect Genet Evol, 2004