<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
ARG4006 ARG4006 Argentina 2001 HIV1 C PBMC None

Treatment History
Order Regimen Weeks
1 None NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35T, T39E, S48T, K122E, A158S, K173A, D177E, T200A, E204K, Q207E, R211K, F214L, V245Q, A272P, E291D, V292I, I293V, E297A, G333E, R356K, G359T, K366R, T377Q, V381I, K390R, A400S, E404D, V435T, L452M, V466I, S468A, H483Q, S519N, K527Q, A534S, A554S, K558R  
>ARG4006| codons 1-560
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICEEMEKEGKITKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPSIFQSSMTKILEPFRAQNPEIVI
YQYMDDLYVGSDLEIGQHRAKIEKLREHLLKWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGTKALTDIVPLTAEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQEQGQWTYQIYQEPFKNLKTGKYAKMRTA
HTNDVRQLTEAVQKIAQESIIIWGKTPKFRLPIQKETWESWWTDYWQATWIPEWEFVNTP
PLVKLWYQLEKEPITGAETFYVDGAANRETKMGKAGYVTDRGRQKIVALTDTTNQKTELQ
AIQLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIQKEKVYLSWVPAHK
GIGGNEQVDKLVSSGIRRVL

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I15V, N37K, R41N, L63V, I64M, H69K, L89M, I93L  
>ARG4006| codons 1-99
PQITLWQRPLVTIKVGGQLKEALLDTGADDTVLEEMKLPGNWKPKMIGGIGGFIKVRQYD
QIVMEICGKKAIGTVLVGPTPVNIIGRNMLTQLGCTLNF

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
    E11D, S24N, D25E, V31I, M50T, L101I, T112V, T124N, T125A, K136Q, V201I, T218I, L234I, I251L, A265V, R269K, D278A  
>ARG4006| codons 1-288
FLDGIDKAQEDHEKYHSNWRAMANEFNLPPIVAKEIVASCDKCQLKGEATHGQVDCSPGI
WQLDCTHLEGKIILVAVHVASGYIEAEVIPAETGQETAYFILKLAGRWPVKVIHTDNGSN
FTSNAVKAACWWAGIQQEFGIPYNPQSQGVVESMNKELKKIIGQVRDQAEHLKTAVQMAV
FIHNFKRKGGIGGYSAGERIIDIIATDIQTKELQKQIIKIQNFRVYYRDSRDPIWKGPAK
LLWKGEGAVVLQDNSDIKVVPRRKVKIIKDYGKQMAGADCVASRQDED

References
Author Title Citation
Carrion, G Documentation of subtype C HIV Type 1 strains in Argentina, Paraguay, and Uruguay. ARHR, 2004