<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
97IC_PCI3 97_PCI3 Cote d'Ivoire 1997 HIV1 CRF02_AG PBMC None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
  L10F I13V, K14R, G17E, K20I, M36I, R41K, K43R, H69K, K70R, L89M  
>97_PCI3| codons 1-99
PQITLWQRPFVTVRIGEQLIEALLDTGADDTVLEEINLPGKWRPKMIGGIGGFIKVRQYD
QILIEICGKRAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V21I, V35L, I135V, I142M, K173I, Q174K, D177E, T200A, Q207E, R211K, V245Q, T286A, E291D, V292I, I293V, P294T, I326V, G335D, R356K, M357K, R358K, G359S, K366R, T369A, E370D, A371V, I375V, A376T, T377L, A400T, E432D, V435I, R461K, D471E, Q480Y, L491S, K512R, S519N, Q524K, K527E, E529A, A534S, A554S, K558T  
>97_PCI3| codons 1-560
PISPIETVPVKLKPGMDGPKIKQWPLTEEKIKALLEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSVNNETPGMRYQYNVLPQGWKGSPAIFQSSMTKILEPFRIKNPEIVI
YQYMDDLYVGSDLEIGQHRAKIEELREHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGAKALTDIVTLTEEAE
LELAENREILKEPVHGVYYDPSKDLVAEIQKQGQDQWTYQIYQEPFKNLKTGKYAKKKSA
HTNDVRQLADVVQKVTLESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTP
PLVKLWYQLEKDPIIGAETFYVDGAANRETKLGKAGYVTDKGRQKVVSLTETTNQKTELY
AIHLALQDSGSEVNIVTDSQYALGIIQAQPDRSESELVNQIIEKLIEKAKVYLSWVPAHK
GIGGNEQVDKLVSSGIRTVL

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
    K14R, V31I, L101I, T112V, T124A, T125A, G134N, I135V, K136T, V201I, T206S, L234I, R269K S283G
>97_PCI3| codons 2-288
LDGIDKAQEEHERYHSNWRAMASDFNLPPIVAKEIVASCDKCQLKGEAMHGQVDCSPGIW
QLDCTHLEGKIILVAVHVASGYIEAEVIPAETGQETAYFILKLAGRWPVKVIHTDNGSNF
TSAAVKAACWWANVTQEFGIPYNPQSQGVVESMNKELKKIIGQVRDQAEHLKTAVQMAVF
IHNFKRKGGIGGYSAGERIIDIIASDIQTKELQKQITKIQNFRVYYRDSRDPIWKGPAKL
LWKGEGAVVIQDNSDIKVVPRRKAKIIKDYGKQMAGDDCVAGRQDED

References
Author Title Citation
Toni, T Presence of CRF09_cpx and complex CRF02_AG/CRF09_cpx recombinant HIV type 1 strains in Cote d'Ivoire, West Africa. ARHR, 2005