<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
TH9_95 TH9_95 Thailand 1997 HIV1 CRF01_AE PBMC None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, E35D, M36I, N37D, R41K, L63P, I93L  
>TH9_95| codons 1-99
PQITLWQRPLVTVKIGGQLKEALLDTGADDTVLEDIDLPGKWKPKMIGGIGGFIKVRQYD
QIPIEICGHKAIGTVLVGPTPVNIIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        K11T, V35T, T39K, K43A, V60I, V111I, K122E, D123S, I132V, I135L, Q207A, R211S, K238R, V245E, T286A, E291D, V292I, I293V, E312T, I326V, I329V, G335N, R356K, M357Q, G359S, D364E, K366R, A371V, T386I, K390R, K395R, A400T, T403M, E432D, D460N, D471E, Q480H, L491S, K512R, L517I, S519N, Q524E, A534S, A554S R72G, R206G
>TH9_95| codons 1-560
PISPIETVPVTLKPGMDGPKVKQWPLTEEKIKALTEICKEMEAEGKISKIGPENPYNTPI
FAIKKKDSTKWGKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDIGDAYFSVPL
DESFRKYTAFTVPSLNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRTKIEELGAHLLSWGFTTPDKKHQKEPPFLWMGYELHPDRWT
VQPIELPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGAKALTDIVPLTEEAE
LELAENREILKTPVHGVYYDPSKDLVAEVQKQGQNQWTYQIYQEPFKNLKTGKYAKQRSA
HTNEVRQLTEVVQKIATESIVIWGKIPKFRLPIQRETWETWWMEYWQATWIPEWEFVNTP
PLVKLWYQLEKDPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVSLTETTNQKTELH
AIHLALQDSGSEVNIVTDSQYALGIIQAQPDRSESEIVNQIIEELIKKEKVYLSWVPAHK
GIGGNEQVDKLVSSGIRKVL

References
Author Title Citation
Ramos, A New HIV type 1 CRF01_AE/B recombinants displaying unique distribution of breakpoints from incident infections among injecting drug users in Thailand. ARHR, 2003