<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CO6770 CO6770 Tanzania 2004 HIV1 C PBMC None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10I, I15V, M36I, N37K, R41N, K45R, C67S, H69K, L89M, I93L  
>CO6770| codons 1-99
PQITLWQRPIVTIKVGGQLKEALLDTGADDTVLEEIKLPGNWKPRMIGGIGGFIKVRQYD
QILIEISGKKAIGTVLVGPTPVNIIGRNMLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        K22R, V35T, E36A, T39E, S48T, K122E, D123G, K173A, D177E, E194N, T200A, Q207E, V245Q, E248D, D250G, A272K, K277R, T286A, E291D, V292I, I293V, D324E, G335D, P345Q, F346H, R356K, G359T, T377Q, K390R, A400I, E404D, V435A, L452M, R461K, V466I, D471E, K476R, H483K, Q487E, L491S, L517I, S519N, K530R, A534S, A554S  
>CO6770| codons 1-560
PISPIETVPVKLKPGMDGPKVRQWPLTEEKIKALTAICEEMEKEGKITKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEGFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRAQNPEIVI
YQYMDDLYVGSDLNIGQHRAKIEELREHLLRWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPDKGSWTVNDIQKLVGKLNWASQIYKGIKVRQLCKLLRGAKALTDIVPLTEEAE
LELAENREILKEPVHGVYYDPSKELIAEIQKQGQDQWTYQIYQEQHKNLKTGKYAKMRTA
HTNDVKQLTEAVQKIAQESIVIWGKTPKFRLPIQKETWEIWWTDYWQATWIPEWEFVNTP
PLVKLWYQLEKEPIAGAETFYVDGAANRETKMGKAGYVTDKGRQKIVSLTETTNQRTELQ
AIKLALEDSGSEVNIVTDSQYALGIIQAQPDKSESEIVNQIIEQLIKKERVYLSWVPAHK
GIGGNEQVDKLVSSGIRKVL

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
    D6E, V31I, V37I, M50I, I84M, L101I, T112V, S119T, T124S, T125A, K136Q, V201I, Q216R, T218L, K219Q, L234I, R269K, D278A  
>CO6770| codons 1-288
FLDGIEKAQEEHEKYHSNWRAMASDFNLPPIVAKEIIASCDKCQLKGEAIHGQVDCSPGI
WQLDCTHLEGKIILVAVHVASGYMEAEVIPAETGQETAYFILKLAGRWPVKVIHTDNGTN
FTSSAVKAACWWAGIQQEFGIPYNPQSQGVVESMNKELKKIIGQVRDQAEHLKTAVQMAV
FIHNFKRKGGIGGYSAGERIIDIIATDIQTKELQKRILQIQNFRVYYRDSRDPIWKGPAK
LLWKGEGAVVIQDNSDIKVVPRRKAKIIKDYGKQMAGADCVASRQDED

References
Author Title Citation
Arroyo, MA HIV-1 diversity and prevalence differ between urban and rural areas in the Mbeya region of Tanzania. AIDS, 2005