<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
01BR042 01BR042 Brazil 2001 HIV1 F PBMC None

Treatment History
Order Regimen Weeks
1 PI|RTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I15V, L19V, E35D, M36I, R41K, R57K, Q61N, K70R, I72T  
>01BR042| codons 1-99
PQITLWQRPLVTIKVGGQVKEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVKQYD
NILIEICGHRATGTVLVGPTPVNIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        P14L, D123E, S162C, F171Y, K173A, Q174K, D177E, I178L, G196E, Q207E, R211K, F214L, V245Q, E248D, A272P, V276I, E291D, V292I, I293V, E297A, K311R, R356K, M357K, G359S, T377L, E399N, A400T, K431T, A446S, N447S, L452K, V466A, D471E, T477A, H483Q, L491S, K512Q, S519N, K527N, A534S, V559I  
>01BR042| codons 1-560
PISPIETVPVKLKLGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPYRAKNPELVI
YQYMDDLYVGSDLEIEQHRTKIEELREHLLKWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPDKDSWTVNDIQKLVGKLNWASQIYPGIKIKQLCKLLRGTKALTDIVPLTAEAE
LELAENREILREPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYAKKRSA
HTNDVKQLTEAVQKIALESIVIWGKTPKFKLPIQKETWNTWWTEYWQATWIPEWEFVNTP
PLVKLWYQLETEPIVGAETFYVDGASSRETKKGKAGYVTDRGRQKAVSLTETTNQKAELQ
AIQLALQDSGSEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLINKEKVYLSWVPAHK
GIGGNEQVDKLVSAGIRKIL

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
    S17N, V31I, I72V, I84L, L101I, S119T, T124A, T125A, K136Q, V201I, T218I, L234V, D256E S283G
>01BR042| codons 1-288
FLDGIDKAQEEHEKYHNNWRAMASDFNLPPIVAKEIVASCDKCQLKGEAMHGQVDCSPGI
WQLDCTHLEGKVILVAVHVASGYLEAEVIPAETGQETAYFILKLAGRWPVKTIHTDNGTN
FTSAAVKAACWWAGIQQEFGIPYNPQSQGVVESMNKELKKIIGQVRDQAEHLKTAVQMAV
FIHNFKRKGGIGGYSAGERIIDIIATDIQTKELQKQIIKIQNFRVYYRDSRDPVWKGPAK
LLWKGEGAVVIQDNSEIKVVPRRKAKIIRDYGKQMAGDDCVAGRQDED

References
Author Title Citation
Sanabani, S Analysis of the near full length genomes of HIV-1 subtypes B, F and BF recombinant from a cohort of 14 patients in Sao Paulo, Brazil. Infect Genet Evol, 2006