<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
BR60 BR60 Brazil 1994 HIV1 F PBMC None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    E35D, M36I, R41K, R57K, Q61N, V77I, L89M  
>BR60| codons 1-99
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVKQYD
NILIEICGHKAIGTVLIGPTPVNIIGRNMLTQIGCTLNF

References
Author Title Citation
Tanuri, A Genetic variation and susceptibilities to protease inhibitors among subtype B and F isolates in Brazil. AAC, 1999
Ramos, A Dual and recombinant infections: an integral part of the HIV-1 epidemic in Brazil. Emerg Infect Dis, 1999