<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
00TH_R1741 00_R1741 Thailand 2000 HIV1 CRF52_01B PBMC None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10I, I13V, E35D, M36I, N37D, R41K, H69K, L89M  
>00_R1741| codons 1-99
PQITLWQRPIVTVKIGGQLKEALLDTGADDTVLEDIDLPGKWKPKMIGGIGGFIKVRQYD
QILIEICGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        E6D, V35T, K122E, I135R, S162C, R211K, V245E, I293V, P294A, E297T, E312T, I326V, I329V, G335D, M357K, G359S, K366R, A371V, T377L, S379C, K390R, A400T, T403M, E432D, D460N, R461K, D471E, Q480H, H483Y, L491S, K512R, E514D, L517I, S519N, Q524E, A534S, A554S  
>00_R1741| codons 1-560
PISPIDTVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSRNNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRTKIEELRQHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIELPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGTKALTEVVALTTEAE
LELAENREILKTPVHGVYYDPSKDLVAEVQKQGQDQWTYQIYQEPFKNLKTGKYARKRSA
HTNDVRQLTEVVQKIALECIVIWGKTPKFRLPIQKETWETWWMEYWQATWIPEWEFVNTP
PLVKLWYQLEKDPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVSLTETTNQKTELH
AIYLALQDSGSEVNIVTDSQYALGIIQAQPDRSDSEIVNQIIEELIKKEKVYLSWVPAHK
GIGGNEQVDKLVSSGIRKVL

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
    K14R, A21T, V31I, V32I, I72V, L101I, T112V, T124G, T125A, G134N, I135V, K136Q, K160R, D167E, V201I, T218S, L234I S283G
>00_R1741| codons 1-288
FLDGIDKAQEEHERYHSNWRTMASDFNLPPIIAKEIVASCDKCQLKGEAMHGQVDCSPGI
WQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFILKLAGRWPVKVIHTDNGSN
FTSGAVKAACWWANVQQEFGIPYNPQSQGVVESMNKELKRIIGQVREQAEHLKTAVQMAV
FIHNFKRKGGIGGYSAGERIIDIIATDIQTKELQKQISKIQNFRVYYRDSRDPIWKGPAK
LLWKGEGAVVIQDNSDIKVVPRRKAKIIRDYGKQMAGDDCVAGRQDED

References
Author Title Citation
Watanaveeradej, V Molecular epidemiology of HIV type 1 in preparation for a phase III prime-boost vaccine trial in Thailand and a new approach to HIV type 1 genotyping. ARHR, 2006
Liu, Y Identification of a novel HIV type 1 circulating recombinant form (CRF52_01B) in Southeast Asia. ARHR, 2012