<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
04AR158637 04AR158637 Argentina 2004 HIV1 F PBMC None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12S, I15V, Q18E, E35D, M36I, P39T, R41K, Q61N, L63T, E65D, I72T  
>04AR158637| codons 1-99
PQITLWQRPLVSIKVGGELKEALLDTGADDTVLEDINLTGKWKPKMIGGIGGFIKVRQYD
NITIDICGHKATGTVLVGPTPVNIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        K32I, V35T, T39K, I142V, S162A, G196V, T200A, Q207K, R211A, A272P, K277R, T286A, V292I, E297R, Q334L, T377L, S379A, I380V, K390R, Q394L, E399D, A400T, K431T, V435A, A446S, E449D, L452E, V466A, S468P, D471E, T477A, Q480H, H483Q, S519N, K527S, A534S  
>04AR158637| codons 1-560
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIIALTEICKEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGVRYQYNVLPQGWKGSPAIFQASMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIVQHRAKIEELRKHLLAWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGAKALTEIIPLTREAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGLGQWTYQIYQEPFKNLKTGKYARMRGA
HTNDVKQLTEAVQKIALEAVVIWGKTPKFRLPILKETWDTWWTEYWQATWIPEWEFVNTP
PLVKLWYQLETEPIAGAETFYVDGASNRDTKEGKAGYVTDRGRQKAVPLTETTNQKAELH
AIQLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLISKEKVYLSWVPAHK
GIGGNEQVDKLVSAGIRKVL

References
Author Title Citation
Pando, MA First report of an HIV-1 triple recombinant of subtypes B, C and F in Buenos Aires, Argentina. Retrovirology, 2006