<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
04AR151516 04AR151516 Argentina 2004 HIV1 B PBMC None

Treatment History
Order Regimen Weeks
1 None NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        D121Y, K122E, I135T, I202V, Q207K, R211K, A272G, T286A, A288S, I293V, E297K, G333D, R356RK, Q373N, S379G, T386I, K390R, E399D, T403M, V435A, K454R, L517I, K530R, A554S  
>04AR151516| codons 1-560
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
YEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRTKVEELRKHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYGGIKVKQLCKLLRGAKSLTEVVPLTKEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQDQGQWTYQIYQEPFKNLKTGKYAKMRGA
HTNDVKQLTEAVNKIATEGIVIWGKIPKFRLPIQKETWDAWWMEYWQATWIPEWEFVNTP
PLVKLWYQLEKEPIAGAETFYVDGAANRETKLGRAGYVTDRGRQKVVSLTDTTNQKTELQ
AIHLALQDSGLEVNIVTDSQYALGIIQAQPDKSESEIVSQIIEQLIKKERVYLAWVPAHK
GIGGNEQVDKLVSSGIRKVL

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12N, L19I, E35D, R41K, L63S, I72V  
>04AR151516| codons 1-99
PQITLWQRPLVNIKIGGQIKEALLDTGADDTVLEDMNLPGKWKPKMIGGIGGFIKVRQYD
QISIEICGHKAVGTVLVGPTPVNIIGRNLLTQIGCTLNF

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
    E11D, S24N, M50I, I72V, L101I, K136N G237R
>04AR151516| codons 1-288
FLDGIDKAQEDHEKYHSNWRAMANDFNLPPVVAKEIVASCDKCQLKGEAIHGQVDCSPGI
WQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFILKLAGRWPVKTIHTDNGSN
FTSTTVKAACWWAGINQEFGIPYNPQSQGVVESMNKELKKIIGQVRDQAEHLKTAVQMAV
FIHNFKRKGGIGGYSAGERIVDIIATDIQTKELQKQITKIQNFRVYYRDSRDPLWKRPAK
LLWKGEGAVVIQDNSDIKVVPRRKAKIIRDYGKQMAGDDCVASRQDED

References
Author Title Citation
Pando, MA First report of an HIV-1 triple recombinant of subtypes B, C and F in Buenos Aires, Argentina. Retrovirology, 2006