<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
02AR115455 02AR115455 Argentina 2002 HIV1 F PBMC None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I15V, E35D, M36I, R41K, R57K, Q61N, L63S, H69Y, I72T  
>02AR115455| codons 1-99
PQITLWQRPLVTIKVGGQLKEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVKQYD
NISIEICGYKATGTVLVGPTPVNIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        D123E, I135T, D177E, Q197P, T200E, I202V, Q207N, D237DN, K249R, A272P, K281R, V292I, I293V, E297K, K311R, I329L, T386I, K390R, Q394L, K395R, E399D, A400T, K431T, V435A, A446S, L452K, V466T, S468P, D471E, T477A, H483Q, L484I, L491S, S519N, K527KR, A534S, V559I  
>02AR115455| codons 1-560
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPEIVI
YQYMDDLYVGSDLEIGPHREKVEELRNHLLRWGFTTPDKKHQKEPPFLWMGYELHPNKWT
VQPIVLPERDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCRLLRGTKALTEIVPLTKEAE
LELAENREILREPVHGVYYDPSKDLIAELQKQGQGQWTYQIYQEPFKNLKTGKYARMRGA
HTNDVKQLTEAVQKIATESIVIWGKIPKFRLPILRETWDTWWTEYWQATWIPEWEFVNTP
PLVKLWYQLETEPIAGAETFYVDGASNRETKKGKAGYVTDRGRQKTVPLTETTNQKAELQ
AIQIALQDSGSEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIRKEKVYLSWVPAHK
GIGGNEQVDKLVSAGIRKIL

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
    E11D, S17T, A23V, L28I, V37I, L45I, I84L, L101I, T112V, S119P, K136Q, D167E, H171Q, V201I, K211R, T218I, L234V, D256E, D270DN W131W*
>02AR115455| codons 1-288
FLDGIDKAQEDHEKYHTNWRAMVSDFNIPPVVAKEIIASCDKCQIKGEAMHGQVDCSPGI
WQLDCTHLEGKIILVAVHVASGYLEAEVIPAETGQETAYFILKLAGRWPVKVIHTDNGPN
FTSTTVKAAC*WAGIQQEFGIPYNPQSQGVVESMNKELKKIIGQVREQAEQLKTAVQMAV
FIHNFKRKGGIGGYSAGERIIDIIATDIQTRELQKQIIKIQNFRVYYRDSRDPVWKGPAK
LLWKGEGAVVIQDNSEIKVVPRRKAKIIRNYGKQMAGDDCVASRQDED

References
Author Title Citation
Pando, MA First report of an HIV-1 triple recombinant of subtypes B, C and F in Buenos Aires, Argentina. Retrovirology, 2006