<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
ZA_BL ZA_BL DRC 1996 HIV1 G Unknown Unknown

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10I, T12K, I13V, K14R, K20I, M36I, N37D, R41K, C67S, H69K, K70R, V82I, L89M  
>ZA_BL| codons 1-99
PQITLWQRPIVKVRIGGQLIEALLDTGADDTVLEEIDLPGKWKPKMIGGIGGFIKVRQYD
QILIEISGKRAIGTVLVGPTPINIIGRNMLTQIGCTLNF

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
    K14R, R20K, V31I, L101I, T112I, T124A, T125A, G134S, K136T, V201I, T206S, L234I, S255N, D256E S283G
>ZA_BL| codons 1-288
FLDGIDKAQEEHERYHSNWKAMASDFNLPPIVAKEIVASCDKCQLKGEAMHGQVDCSPGI
WQLDCTHLEGKIILVAVHVASGYIEAEVIPAETGQETAYFILKLAGRWPVKIIHTDNGSN
FTSAAVKAACWWASITQEFGIPYNPQSQGVVESMNKELKKIIGQVRDQAEHLKTAVQMAV
FIHNFKRKGGIGGYSAGERIIDIIASDIQTKELQKQITKIQNFRVYYRDSRDPIWKGPAK
LLWKGEGAVVIQDNNEIKVVPRRKAKIIRDYGKQMAGDDCVAGRQDED

References
Author Title Citation
Oelrichs, RB Full-length genomic sequence of a subtype G HIV-1 from Kinshasa. ARHR, 1999