<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
03-5355 ML_03-5355 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
    V31I, I72V, E96EG, S119T, V126M, E157Q, K160Q, G193D, S195C, V201I, K211R, N254X, D256E, A265V, I268L  
>ML_03-5355| codons 5-285
IDKAQEEHEKYHSNWRAMASDFNLPPIVAKEIVASCDKCQLKGEAMHGQVDCSPGIWQLD
CTHLEGKVILVAVHVASGYIEAEVIPAETGQGTAYFLLKLAGRWPVKTIHTDNGTNFTST
TMKAACWWAGIKQEFGIPYNPQSQGVVESMNKQLKQIIGQVRDQAEHLKTAVQMAVFIHN
FKRKGGIGDYCAGERIIDIIATDIQTRELQKQITKIQNFRVYYRDSRDPLWKGPAKLLWK
GEGAVVIQDTSEIKVVPRRKVKILRDYGKQMAGDDCVASRQ

References
Author Title Citation
Lataillade, M Natural polymorphism of the HIV-1 integrase gene and mutations associated with integrase inhibitor resistance. Antivir Ther, 2007