<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
MW-ins14 jci-14 U.S. 1998 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 130
2 AZT+DDC 24
3 DDI 20
4 D4T+DDC+PI 130
5 3TC+D4T+NVP NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, I84V, L90M G73S I15V, L19P, K20I, E35G, M36I, I62V, L63P, A71X  
>jci-14| codons 1-99
PQITLWQRPLVTIKVGGQPIEALLDTGADDTVLEGINLPGRWKPKMIGGIGGFVKVRQYD
QVPIEICGHKXISTVLVGPTPVNVIGRNLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, T69A_SG, L74V, M184V, L210W, T215Y A62V, D67E L100I, K103N   K43E, K64R, V111I, K122E, I135T, S162Y, R211RK, L228H, V245E, A272P, K277R  
>jci-14| codons 1-301
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEEEGKISKIGPENPYNTPV
FVIRKKESAKWRKVVDFRELNKRTQDFWEVQLGIPHPAGIKKNKSVTVLDIGDAYFSVPL
DEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQYSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRTKIEELRQHLWKWGFYTPDKKHQKEPPFHWMGYELHPDKWT
VQPIELPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAE
L

References
Author Title Citation
Winters, MA A 6-basepair insert in the reverse transcriptase gene of human immunodeficiency virus type 1 confers resistance to multiple nucleoside inhibitors. J Clin Invest, 1998
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005