<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
MW-ins13 jci-13 U.S. 1998 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 156
2 AZT+DDC 20
3 3TC+AZT 24
4 D4T+DDI 36
5 3TC+AZT+IDV 24
6 D4T+DDI+NVP+PI 24

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, V82A, L90M   L10I, K20R, E35D, M36I, N37X, R41X, D60E, I62V, L63P, A71V, I72X  
>jci-13| codons 1-99
PQITLWQRPIVTIKIGGQLREALLDTGADDTVLEDIXLPGXWKPKMIGGIGGFVKVRQYE
QVPIEICGHKVXGTVLVGPTPANIIGRNLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
T69S_SS, K70R, V75M, L210W, T215F D67E     K43Q, V118VI, K122E, D123E, K166R, G196E, R211K, A272P, K277R, I293V, P294A, E297A  
>jci-13| codons 1-302
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEQEGKISKIGPENPYNTPV
FAIKKKESSRWRKLMDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSIPL
DEEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTRILEPFRKQNPDIVI
YQYMDDLYVGSDLEIEQHRTKIEELRQHLWKWGFFTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVVALTAEAE
LE

References
Author Title Citation
Winters, MA A 6-basepair insert in the reverse transcriptase gene of human immunodeficiency virus type 1 confers resistance to multiple nucleoside inhibitors. J Clin Invest, 1998
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005