<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
MW-ins3 jci-3 U.S. 1998 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 121
2 AZT+DDI 52
3 AZT+DDC 40
4 3TC+AZT+DDC 52
5 3TC+D4T+IDV 104
6 3TC+AZT+PI 40
7 Unknown NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, L90M Q58E, G73T L10V, E35D, M36I, N37D, I62X, L63P, I64V, A71V  
>jci-3| codons 1-99
PQITLWQRPVVTIKIGGQLKEALLDTGADDTVLEDIDLPGRWKPKMIGGIGGFVKVREYD
QXPVEICGHKVITTVLVGPTPVNIIGRNLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, T69S_SA, T215Y A62V K103N, Y181C   E6D, K20R, K43Q, V118I, S162A, Q207E, R211K, L228H  
>jci-3| codons 1-230
PISPIDTVPVKLKPGMDGPRVKQWPLTEEKIKALVEICTELEQEGKISKIGPENPYNTPV
FVIKKKDSSKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSIPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQASMTKILEPFRKQNPDIVI
CQYMDDLYVGSDLEIGQHRTKIEELREHLLKWGFYTPDKKHQKEPPFHWM

References
Author Title Citation
Winters, MA A 6-basepair insert in the reverse transcriptase gene of human immunodeficiency virus type 1 confers resistance to multiple nucleoside inhibitors. J Clin Invest, 1998
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005