<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA38129 CA84910 U.S. 2007 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 NNRTI|NRTI|PI NA
2 Unknown 52
3 DRV+FTC+RTV+TDF 23

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, T69D, K70R, Q151M, M184V F116Y, T215V, K219Q K101E, Y181C V179F E28K, K32E, V35T, V60I, V118I, K122E, D123E, F214L, L228H, T286A, I293V  
>CA84910| codons 1-301
PISPIETVPVKLKPGMDGPKVKQWPLTKEKIEALTEICTEMEKEGKISKIGPENPYNTPI
FAIKKKNSDRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLEKKKSVTVLDVGDAYYSIPL
DEEFRKYTAFTIPSINNETPGIRYQYNVLPMGWKGSPAIFQSSMTKILEPFRKQNPDIFI
CQYVDDLYVGSDLEIGQHRTKIEELRQHLLRWGLVTPDQKHQKEPPFHWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGAKALTEVVPLTEEAE
L

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V32I, M46I, I47V, I54M, I84IV, L90M V11I, L33LF, Q58E, G73S, L89V L10I, T12K, I13V, K20V, E35G, M36I, N37ND, R57K, L63P, I64V, A71IV  
>CA84909| codons 1-99
PQITLWQRPIIKVKIGGQLVEALLDTGADDTIFEGIDLPGRWKPKIVGGIGGFMKVKEYD
QIPVEICGHKVISTVLVGPTPVNVIGRNVMTQIGCTLNF

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
    S39C, L101I, S119ST, T124A, T125A, K156N, R187K, V201I, T218I  
>CA158558| codons 1-288
FLDGIDKAQEEHEKYHSNWRAMASDFNLPPVVAKEIVACCDKCQLKGEAMHGQVDCSPGI
WQLDCTHLEGKIILVAVHVASGYIEAEVIPAETGQETAYFILKLAGRWPVKTIHTDNGTN
FTSAAVKAACWWAGIKQEFGIPYNPQSQGVVESMNNELKKIIGQVRDQAEHLKTAVQMAV
FIHNFKKKGGIGGYSAGERIIDIIATDIQTKELQKQIIKIQNFRVYYRDSRDPLWKGPAK
LLWKGEGAVVIQDNSDIKVVPRRKAKIIRDYGKQMAGDDCVASRQDED

References
Author Title Citation
Melikian, GL Standardized comparison of the relative impacts of HIV-1 reverse transcriptase (RT) mutations on nucleoside RT inhibitor susceptibility. AAC, 2012