<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
J-A J-A U.S. 1997 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 52
2 DDI 52
3 3TC+AZT+D4T+IDV 17
4 3TC+AZT+D4T+NFV 35
5 3TC+D4T+RTV+SQV 20

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, T69A_SS, M184V, T215Y A62V     K20R, K43N, V118VI, K122KE, S162C, D177E, R211K, L228LH  
>J-A| codons 1-251
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALVEICTELENEGKISKIGPENPYNTPV
FVIKKKDSAKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSIPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKQNPEIVI
YQYVDDLYVGSDLEIGQHRTKIEELRQHLLKWGFYTPDKKHQKEPPFHWMGYELHPDKWT
VQPIVLPEKDS

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, V82A L24I, L33IV, F53FL L10I, M36MV, N37D, P39X, R41X, I62V, L63P, A71V, I72V  
>J-A| codons 1-99
PQITLWQRPIVTIKIGGQLKEALIDTGADDTVVEEIDLXGXWKPKIIGGIGGLVKVRQYD
QVPIEICGHKVVGTVLVGPTPANIIGRNLLTQIGCTLNF

References
Author Title Citation
Winters, MA A 6-basepair insert in the reverse transcriptase gene of human immunodeficiency virus type 1 confers resistance to multiple nucleoside inhibitors. J Clin Invest, 1998
Gonzales, MJ Extended spectrum of HIV-1 reverse transcriptase mutations in patients receiving multiple nucleoside analog inhibitors. AIDS, 2003
Gonzales, MJ Protease and reverse transcriptase mutation patterns in HIV-1 isolates from heavily treated persons: comparison of isolates from northern California with isolates from other regions. ARHR, 2003
Rhee, SY HIV-1 Protease and Reverse Transcriptase Mutations: Correlations with Antiretroviral Therapy in Subtype B Isolates and Implications for Drug-Resistance Surveillance. J Infect Dis, 2005