<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
MW-ins4 jci-4-897 U.S. 1997 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 52
2 AZT+DDC 104
3 AZT+DDI 104
4 AZT+DDI+SQV 52
5 AZT+DDI+IDV 52
6 3TC+D4T+NVP NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I84V, L90M L10F T12N, L19T, K20I, E35D, M36I, N37D, R57K, I62V, L63P, A71V, Q92R  
>jci-4-897| codons 1-99
PQITLWQRPFVNIKIGGQTIEALLDTGADDTVLEDIDLPGRWKPKMIGGIGGFIKVKQYD
QVPIEICGHKVIGTVLVGPTPVNVIGRNLMTRIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, T69S_SG, T215Y D67E     E6ED, V35E, T39A, W88C, K122E, I135T, I142T, S162A, Q207E  
>jci-4-897| codons 1-253
PISPIDTVPVKLKPGMDGPKVKQWPLTEEKIKALEEICAELEKEGKISKIGPENPYNTPV
FAIKKKESSKWRKLVDFRELNKRTQDFCEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSTNNETPGTRYQYNVLPQGWKGSPAIFQASMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRTKIEELREHLLRWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWT

References
Author Title Citation
Winters, MA A 6-basepair insert in the reverse transcriptase gene of human immunodeficiency virus type 1 confers resistance to multiple nucleoside inhibitors. J Clin Invest, 1998
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005