<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA2084 CA8472 U.S. 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 261
2 AZT+ 3TC 41
3 D4T+ 3TC+ IDV 48
4 DDC+ 3TC+ NFV 28
5 DDI+ 3TC+ NFV 29
6 ABC+ EFV+ SQV 7

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, N88S L10F, Q58E I13V, K14R, K20I, N37D, L63Q, I64V, I72V, I93L  
>CA8472| codons 10-99
FVTVRIGGQLIEALLDTGADDTVLEEMDLPGRWKPKIIGGIGGFIKVREYDQIQVEICGH
KAVGTVLVGPTPVNIIGRSLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, M184V K219Q     K20R, T39N, V60I, T69N, K70X, D123E, I135T, D177E, D218E, A272P, T286A  
>CA8471| codons 1-300
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALVEICNEMEKEGKISKIGPENPYNTPI
FAIKKKNSNXWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPEIVI
YQYVDDLYVGSDLEIGQHRTKIEELRQHLLRWGFTTPEQKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGAKALTEVIPLTEEAE

References
Author Title Citation
Wu, TD Mutation patterns and structural correlates in human immunodeficiency virus type 1 protease following different protease inhibitor treatments. J Virol, 2003
Gonzales, MJ Protease and reverse transcriptase mutation patterns in HIV-1 isolates from heavily treated persons: Comparison of isolates from northern California with isolates from other regions. ARHR, 2003
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005