<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1961 CA8461 U.S. 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 109
2 AZT+DDI 43
3 AZT+DDC+NVP 57
4 3TC+AZT 117
5 3TC+D4T+RTV+SQV 46
6 3TC+ABC+D4T+EFV 6

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I84V, L90M   L10I, I13V, E35D, M36I, L63P, I64L  
>CA8461| codons 1-99
PQITLWQRPIVTVKIGGQLKEALLDTGADDTVLEDINLPGRWKPKMIGGIGGFIKVRQYD
QIPLEICGHKAIGTVLVGPTPVNVIGRNLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69D, M184V, L210W, T215Y A62AV, V75S     T39E, E44D, E53D, K122E, D123S, I178L, R211K  
>CA8462| codons 1-274
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICEELEKDGKISKIGPDNPYNTPV
FVIKKKNSDKWRKLSDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DESFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDLVI
YQYVDDLYVGSDLEIGQHRTKIEELRQHLWKWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGI

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005