<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1426 CA8459 U.S. 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 35
2 AZT+D4T+SQV 30
3 3TC+D4T+IDV 83
4 D4T+DDC+NFV 29
5 DDI+RTV+SQV 8
6 DDC+RTV+SQV 21

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
L90M G73S L10I, K20I, N37A, R41K, I62V, L63P, A71V, V77I, I93L  
>CA8459| codons 1-99
PQITLWQRPIVTIKIGGQLIEALLDTGADDTVLEEMALPGKWKPKMIGGIGGFIKVRQYD
QVPIEICGHKVISTVLIGPTPVNIIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R K219KQ     T58TN, V60I, T69N, K122E, I135V, L193LF, G196X, V245MT N137NI, P226PS, L234LH
>CA8458| codons 1-259
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNNPI
FAIKKKNSNRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSVNIETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDFEIEQHRTKIEELRQHLLRWGFTTPDQKHQKEPSFLWMGYEHHPDKWT
VQPITLPEKDSWTVNDIQK

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005