<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA37947 CA84537 U.S. 2007 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 174
2 3TC+AZT 52
3 3TC+AZT+NFV 503

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
D30N L33F, N88D N37S, R57K, I62V, L63H, A71IV, V77I, I85IV  
>CA84537| codons 1-99
PQITLWQRPLVTIKIGGQLKEALLDTGADNTVFEEMSLPGRWKPKMIGGIGGFIKVKQYD
QVHIEICGHKVIGTVLIGPTPVNIVGRDLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, M184V, L210LW, T215Y       T39TA, K43KE, E44EA, V60VI, V118VI, K122E, I142V, E203ED, Q207E, H208HY, R211K, A272P, R284K, T286TA  
>CA84538| codons 1-300
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICAELEEAGKISKIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSIPL
DEDFRKYTAFTIPSINNETPGVRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRTKIDELREYLWKWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLKGAKALTEVIPLTEEAE

References
Author Title Citation
Rhee, SY Predictive value of HIV-1 genotypic resistance test interpretation algorithms. J Infect Dis, 2009