<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA35628 CA84365 U.S. 2007 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, V82A, L90M Q58E, G73S L10I, I15V, L19I, K20R, E35D, M36I, N37E, R41K, D60N, I62V, L63P, K70R, A71V, I93L  
>CA84365| codons 1-99
PQITLWQRPIVTIKVGGQIREALLDTGADDTVLEDIELPGKWKPKMIGGIGGFVKVREYN
QVPIEICGHRVISTVLVGPTPANIIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
Y115F, Q151M, M184V A62V, V75I, F77L, F116Y   V108I K11R, V35I, K46Q, K49R, D123E, D177E, Q207N, R211K, A272AP, K277KR, A288S, I293V, K311R, Q334L, R358K, K390R, V435I, T470N, A554T, K558R  
>CA84366| codons 1-560
PISPIETVPVRLKPGMDGPKVKQWPLTEEKIKALIEICTEMEKEGQISRIGPENPYNTPV
FVIKKKDSTKWRKLIDLRELNKRTQDFWEVQLGIPHPAGLKKKKSVTILDVGDAFYSVPL
DKEFRKYTAFTIPSINNETPGIRYQYNVLPMGWKGSPAIFQSSMTKILEPFRKQNPEIVI
YQYVDDLYVGSDLEIGQHRTKIEELRNHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKSLTEVVPLTEEAE
LELAENREILREPVHGVYYDPSKDLIAEIQKQGLGQWTYQIYQEPFKNLKTGKYARMKGA
HTNDVKQLTEAVQKIATESIVIWGKTPKFRLPIQKETWEAWWTEYWQATWIPEWEFVNTP
PLVKLWYQLEKEPIIGAETFYVDGAANRETKLGKAGYVTDRGRQKVVSLNDTTNQKTELQ
AIHLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVSQIIEQLIKKEKVYLAWVPAHK
GIGGNEQVDKLVSTGIRRVL

References
Author Title Citation
Rhee, SY HIV-1 protease mutations and protease inhibitor cross resistance. AAC, 2010