<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1468 CA8436 U.S. 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 178
2 3TC+Unknown 122
3 NVP+Unknown 31
4 3TC+D4T+DDI+RTV+SQV 4
5 3TC+DDI+RTV+SQV 26
6 3TC+D4T+DDI+RTV+SQV 5

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, L90M G73C L10I, N37D, L63P, V77I, I93L  
>CA8436| codons 1-99
PQITLWQRPIVTIKIGGQLKEALLDTGADDTVLEEMDLPGRWKPKLIGGIGGFIKVRQYD
QIPIEICGHKAICTVLIGPTPVNIIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L74I, M184V, L210W, T215Y       R83K, T139M, S162A, S163T, T165I, D177E, I195IV, R211K H198HL, K223KN
>CA8435| codons 1-237
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKIVDFRELNKKTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNEMPGIRYQYNVLPQGWKGSPAIFQATMIKILEPFRKQNPEIVI
YQYVDDLYVGSDLEVGQLRTKIEELRQHLWKWGFYTPDKKHQNEPPFLWMGYELHPD

References
Author Title Citation
Kantor, R Evolution of primary protease inhibitor resistance mutations during protease inhibitor salvage therapy. AAC, 2002
Wu, TD Mutation patterns and structural correlates in human immunodeficiency virus type 1 protease following different protease inhibitor treatments. J Virol, 2003
Gonzales, MJ Protease and reverse transcriptase mutation patterns in HIV-1 isolates from heavily treated persons: Comparison of isolates from northern California with isolates from other regions. ARHR, 2003
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005