<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA30205 CA84347 U.S. 2007 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 ABC+AZT+NFV 300
2 ABC+FTC+NFV+TDF 36

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46MI, L90M   L10LI, I13V, K14R, I15V, K20T, I62IV, L63P, A71I, T74S, V77I, I93L  
>CA84347| codons 1-99
PQITLWQRPIVTVRVGGQLTEALLDTGADDTVLEEMNLPGRWKPKIIGGIGGFIKVRQYD
QVPIEICGHKIIGSVLIGPTPVNIIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, M184V, T215Y K219R     E44ED, V60I, K122E, I135T, G196E, T200A, H208Y, D218E, L228H, V245L, E248D, K275KR, Q278E, V292I, I293V, E297K  
>CA84348| codons 1-301
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEKDGKISKIGPENPYNTPI
FAIKKKNSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIEQHRAKIEELRQYLLRWGFYTPERKHQKEPPFHWMGYELHPDKWT
VQPILLPDKDSWTVNDIQKLVGKLNWASQIYAGIRVKELCKLLRGTKALTEIVPLTKEAE
L

References
Author Title Citation
Rhee, SY Predictive value of HIV-1 genotypic resistance test interpretation algorithms. J Infect Dis, 2009