<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA25655 CA84315 U.S. 2007 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 NNRTI|NRTI|PI NA
2 Unknown 52
3 APV+FTC+RTV 74

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46ML, I54V, V82C, L90M L10F, L33F, G73S, L89V I13IV, N37S, R41K, K43R, K55R, R57K, I62V, L63P, I64IM, A71V, I93L  
>CA84315| codons 1-99
PQITLWQRPFVTVKIGGQLKEALLDTGADDTVFEEMSLPGKWRPKLIGGIGGFVRVKQYD
QVPMEICGHKVISTVLVGPTPCNIIGRNVMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41ML, D67N, M184V, L210W, T215Y K219KE K103N   K20R, T39TAEK, E40EK, K43KN, V60I, V118I, I142IV, Q174N, D177DN, V179VI, D192DN, G196E, E203A, Q207E, R211K, E224D, L228H, A272P, K277R, I293IV, P294T  
>CA84316| codons 1-302
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALVEICKKLENEGKISKIGPENPYNTPI
FAIKKKNSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSIPL
DKDFRKYTAFTIPSINNETPGVRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKNNPNIII
YQYVDDLYVGSNLEIEQHRTKIAELREHLWKWGFYTPDEKHQKDPPFHWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVVTLTEEAE
LE

References
Author Title Citation
Rhee, SY HIV-1 protease mutations and protease inhibitor cross resistance. AAC, 2010