<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA25135 CA84310 U.S. 2007 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 EFV+FTC+TDF 92

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, T69D, M184V K219Q K103N, G190A   V35I, V60I, K104R, K122E, I135K, K166R, G196E, F214L, V245E, E248D, S251N, A272P, K277R Y232H
>CA84310| codons 1-301
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALIEICTEMEKEGKISKIGPENPYNTPI
FAIKKKNSDKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNRSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSKNNETPGIRYQYNVLPQGWKGSPAIFQSSMTRILEPFRKQNPDIVI
YQYVDDLYVASDLEIEQHRTKIEELRQHLLRWGLTTPDQKHQKEPPFLWMGHELHPDKWT
VQPIELPDKDNWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAE
L

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12TAEK, I13V, K14KR, L63P, I72V, V77I, P79D  
>CA84309| codons 1-99
PQITLWQRPLVKVRIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QIPIEICGHKAVGTVLIGDTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Rhee, SY Predictive value of HIV-1 genotypic resistance test interpretation algorithms. J Infect Dis, 2009