<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1846 CA8428 U.S. 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT+DDC 30
2 AZT+D4T 52
3 AZT+DDI 22
4 3TC+AZT+DDI+SQV 13
5 D4T+IDV 17
6 3TC+D4T+IDV 70
7 DDI+NFV+NVP 35
8 3TC+D4T+RTV+SQV 23

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I84V, L90M L10F K20I, E35D, M36I, L63P, A71V, I72T  
>CA8428| codons 1-99
PQITLWQRPFVTIKIGGQLIEALLDTGADDTVLEDINLPGRWKPKMIGGIGGFIKVRQYD
QIPIEICGHKVTGTVLVGPTPVNVIGRNLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69D, K70R, M184V, T215F V75M, K219Q K101KE, Y181C, G190S A98G K20R, V35L, T39A, K43E, V60I, D86E, V118I, I135V, S162D, V179I, G196E, T200TS, I202IT, R206RI, R211K, F214L R199RI, K201KQ, E203KN, L205LV
>CA8427| codons 1-219
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALLEICAELEEEGKISKIGPENPYNTPI
FAIKKKNSDRWRKLMDFRELNKRTQEFWEVQLGIPHPGGLEKKKSVTVLDVGDAYFSIPL
DKDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQDSMTKILEPFRKQNPDIII
CQYVDDLYVSSDLEIEQHISQTKEVIQHLLKWGLFTPDQ

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005