<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA14400 CA84246 U.S. 2007 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+D4T+NVP 365
2 3TC+ATV+DDI+RTV+TDF 26
3 None 39
4 3TC+ATV+DDI+RTV+TDF 22
5 None 39
6 ATV+DDI+FTC+TDF 27

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V   K103N   T27P, V35I, V90I, K102KR, K122E, I135IV, T139R, D177DE, T200A, R211K, K281KR, T286A, A288S, E297K, S322T, Q334L, A355AT, R358K, G359S, A376S, T386L, E404D, K454R, K512R, L517I, S519N, V531I, K550R  
>CA84246| codons 1-560
PISPIETVPVKLKPGMDGPKVKQWPLPEEKIKALIEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEIQLGIPHPAGLKRNKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSVNNERPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPEIVI
YQYVDDLYVGSDLEIGQHRAKIEELRQHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCRLLRGAKSLTEVIPLTKEAE
LELAENREILKEPVHGVYYDPTKDLIAEIQKQGLGQWTYQIYQEPFKNLKTGKYTRMKSA
HTNDVKQLTEAVQKISTESIVIWGKLPKFKLPIQKETWEAWWTDYWQATWIPEWEFVNTP
PLVKLWYQLEKEPIVGAETFYVDGAANRETKLGRAGYVTDRGRQKVVSLTDTTNQKTELQ
AIHLALQDSGLEVNIVTDSQYALGIIQAQPDRSESEIVNQIIEQLIKKEKIYLAWVPAHK
GIGGNEQVDRLVSAGIRKVL

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    E35D, N37NS, R41K, D60E, L63P, V77VI  
>CA84245| codons 1-99
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEDMSLPGKWKPKMIGGIGGFIKVRQYE
QIPIEICGHKAIGTVLIGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Rhee, SY Predictive value of HIV-1 genotypic resistance test interpretation algorithms. J Infect Dis, 2009