<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1588 CA8423 U.S. 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT+ DDI+ DLV 20
2 3TC+ D4T+ SQV 15
3 3TC+ AZT+ IDV 97
4 D4T+DDI+NVP+RTV+SQV 8
5 D4T+DDI+NFV+SQV 38

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, V82A L24I, F53L L10I, R41K, K55KR, I62V, L63P, I64V, T74S, I93L  
>CA8423| codons 1-99
PQITLWQRPIVTIKIGGQLKEALIDTGADDTVLEEMNLPGKWKPKIIGGIGGLVRVRQYD
QVPVEICGHKAIGSVLVGPTPANIIGRNLLTQLGCTLNF

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005