<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA14237 CA84229 U.S. 2007 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 IDV NA
2 Unknown 329

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
  G73S L10I, N37D, R57K, I62V, L63P, A71T, I72IMT, V77I, I85V, I93L  
>CA84229| codons 1-99
PQITLWQRPIVTIKIGGQLKEALLDTGADDTVLEEMDLPGRWKPKMIGGIGGFIKVKQYD
QVPIEICGHKTTSTVLIGPTPVNIVGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N       S162CHRY, D177DE, G196E, Q207H, R211K, K277R, I293V Q269QH
>CA84230| codons 1-299
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKNSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQYSMTKILEPFRKQNPEIVI
YQYMDDLYVGSDLEIEQHRTKIEELRHHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASHIYAGIKVRQLCKLLRGTKALTEVVPLTEEA

References
Author Title Citation
Rhee, SY HIV-1 protease mutations and protease inhibitor cross resistance. AAC, 2010