<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA14205 CA84222 U.S. 2007 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+AZT+IDV 65
2 3TC+D4T+NFV 430

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V       K11KR, K122P, I142V, I178IM, L210F, R211K, K277R, E291D  
>CA84222| codons 1-299
PISPIETVPVRLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DPDFRKYTAFTIPSINNETPGVRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDMVI
YQYVDDLYVGSDLEIGQHRTKIEELRQHLFKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVRQLCKLLRGTKALTDVIPLTEEA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
  L24LI Q18L, K20KR, E35D, M36I, N37E, D60E, I62V, L63P, I64V, I93IL  
>CA84221| codons 1-99
PQITLWQRPLVTIKIGGLLREALIDTGADDTVLEDIELPGRWKPKMIGGIGGFIKVRQYE
QVPVEICGHKAIGTVLVGPTPVNIIGRNLLTQLGCTLNF

References
Author Title Citation
Rhee, SY Predictive value of HIV-1 genotypic resistance test interpretation algorithms. J Infect Dis, 2009