<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA2321 CA8420 U.S. 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT+3TC 25
2 3TC+AZT+IDV 34
3 3TC+D4T+SQV 44

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
G48V, I84IV, L90M   L10I, T12S, K14KR, L19I, E35ED, R41K, I62V, L63LP, I64V, A71V, I93L  
>CA8420| codons 1-99
PQITLWQRPIVSIRIGGQIKEALLDTGADDTVLEDMNLPGKWKPKMIVGIGGFIKVRQYD
QVPVEICGHKVIGTVLVGPTPVNVIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V A62V   V179D V35T, K103R, I135T, Q174E, R211K, T215X, K259KR, A272S N265NT
>CA8419| codons 1-277
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTEMEKEGKISKIGPENPYNTPV
FVIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKRKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKENPDIDI
YQYVDDLYVGSDLEIGQHRTKIEELRQHLLKWGFXTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQRLVGKLTWASQIYSGIKVK

References
Author Title Citation
Gonzales, MJ HIV-1 reverse transcriptase and protease subtypes: Classification, amino acid mutation patterns, and prevalence in a northern California clinic-based population. J Infect Dis, 2001
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005