<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA7118 CA84197 U.S. 2007 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+AZT+RTV+SQV 78
2 D4T+DDI+EFV 104
3 APV+DDI+LPV+RTV 216
4 ATV+FTC+RTV+TDF 91
5 DRV+FTC+RTV+T20+TDF 25
6 DRV+FTC+RTV+TDF 21

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, I54M, I84V, L90M L10F, V11I, L33F, G73A I13V, G16A, L19LV, E34Q, K43I, G51A, L63P, I64M, C67Y, A71V, I72M  
>CA84197| codons 1-99
PQITLWQRPFITVKIAGQVKEALLDTGADDTVFQEMNLPGRWIPKLIGGIAGFMKVRQYD
QIPMEIYGHKVMATVLVGPTPVNVIGRNLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
T69S_SS, M184V, T215Y A62V, D67EK Y188L   V35L, A98S, V106I, K122E, D123DN, I135T, V189I, T200A, L228H, T286A, E297R  
>CA84198| codons 2-301
ISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALLEICTEMEKEGKISKIGPENPYNTPVF
VIKKKKSSKWRKLVDFRELNKRTQDFWEVQLGIPHPSGLKKKKSITVLDVGDAYFSVPLD
ENFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIY
QYVDDLLIGSDLEIGQHRAKIEELRQHLLRWGFYTPDKKHQKEPPFHWMGYELHPDKWTV
QPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGAKALTEVIPLTREAEL

References
Author Title Citation
Rhee, SY HIV-1 protease mutations and protease inhibitor cross resistance. AAC, 2010