<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA6602 CA84187 U.S. 2007 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 Unknown 52
2 ABC+EFV 65
3 APV+LPV+TDF 209
4 APV+LPV+TDF 93

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, V82F, L90M L33F, K43T, G73AT L10I, I13V, K20R, E35D, M36I, N37E, R57K, D60E, Q61E, I62V, L63P, I64IV, G68E, A71T, I72T, I93L  
>CA84187| codons 1-99
PQITLWQRPIVTVKIGGQLREALLDTGADDTVFEDIELPGRWTPKIIGGIGGFVKVKQYE
EVPVEICEHKTTTTVLVGPTPFNIIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
T215Y A62V, K70N     V35I, A98S, K122E, D123DN, E138Q, S162C, E169D, I178L, T200A, I202IV, R211K, L228R, I257L, A272P, K277R, T286A, A288S, I293V, T296S, E297R  
>CA84188| codons 2-324
ISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALIEICTEMEKEGKISKIGPENPYNTPVF
VIKKKDSTNWRKLVDFRELNKRTQDFWEVQLGIPHPSGLKKKKSVTVLDVGDAYFSVPLD
ENFRKYTAFTIPSINNQTPGIRYQYNVLPQGWKGSPAIFQCSMTKILDPFRKQNPDLVIY
QYMDDLYVGSDLEIGQHRAKVEELRQHLLKWGFYTPDKKHQKEPPFRWMGYELHPDKWTV
QPIVLPEKDSWTVNDLQKLVGKLNWASQIYPGIKVRQLCKLLRGAKSLTEVVPLSREAEL
ELAENREILKEPVHGVYYDPSKD

References
Author Title Citation
Rhee, SY HIV-1 protease mutations and protease inhibitor cross resistance. AAC, 2010