<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA6792 CA84179 U.S. 2007 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 IDV 104
2 3TC+D4T+IDV 57
3 D4T+EFV+RTV+SQV 30
4 3TC+D4T+NFV+NVP 52
5 ABC+D4T+DLV+SQV 148
6 ABC+DDI+FTC+LPV 148

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V32I, M46I, I47IV, I54V, V82A, L90M F53L I15V, K20R, M36I, L63P, A71I, I93L  
>CA84179| codons 1-99
PQITLWQRPLVTIKVGGQLREALLDTGADDTILEEINLPGRWKPKIVGGIGGLVKVRQYD
QIPIEICGHKIIGTVLVGPTPANIIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, M184V, L210W, T215Y   K103N   T39A, T69TA, V90VI, V118I, K122E, I135V, I142V, R211K, V261VG, A272S, K277R, Q278E, I293V, E297K Y232H
>CA84180| codons 1-302
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICAELEKEGKISKIGPENPYNTPV
FAIKKKNSAKWRKLVDFRELNKRTQDFWEIQLGIPHPAGLKKNKSVTVLDVGDAYFSIPL
DEDFRKYTAFTIPSVNNETPGVRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRTKIEELRQHLWKWGFYTPDKKHQKEPPFLWMGHELHPDKWT
VQPIVLPEKDSWTVNDIQKLGGKLNWASQIYSGIKVRELCKLLRGTKALTEVVPLTKEAE
LE

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
    T125A, K156N  
>CA124200| codons 1-288
FLDGIDKAQEEHEKYHSNWRAMASDFNLPPVVAKEIVASCDKCQLKGEAMHGQVDCSPGI
WQLDCTHLEGKIILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTIHTDNGSN
FTSTAVKAACWWAGIKQEFGIPYNPQSQGVVESMNNELKKIIGQVRDQAEHLKTAVQMAV
FIHNFKRKGGIGGYSAGERIVDIIATDIQTKELQKQITKIQNFRVYYRDSRDPLWKGPAK
LLWKGEGAVVIQDNSDIKVVPRRKAKIIRDYGKQMAGDDCVASRQDED

References
Author Title Citation
Rhee, SY HIV-1 protease mutations and protease inhibitor cross resistance. AAC, 2010