<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA798 CA84123 U.S. 2007 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 NRTI 291
2 AZT+DDC+SQV 26
3 None 65
4 3TC+AZT+IDV 105
5 ADV+DDI+EFV 29
6 DDI+EFV 3
7 None 17
8 ABC+ADV+IDV+RTV 10
9 3TC+ADV+D4T+IDV+RTV 5
10 3TC+D4T+IDV+RTV 8
11 None 28
12 D4T+DDI+LPV 42
13 None 13
14 3TC+DDI+RTV+SQV 26
15 None 15
16 DDI+LPV+TDF 94
17 3TC+LPV+TDF 185

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, V82F, L90M Q58E, G73C T4A, L10I, I13V, I15V, K20I, E35DN, M36I, R57K, D60E, Q61N, I62V, L63P, I72T, T74S, Q92K  
>CA84123| codons 1-99
PQIALWQRPIVTVKVGGQLIEALLDTGADDTVLENINLPGRWKPKIIGGIGGFVKVKEYE
NVPIEICGHKATCSVLVGPTPFNIIGRNLMTKIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69D, M184V, L210W, T215Y       K20R, V35M, K43E, K82R, V118I, K122E, D177E, G196E, E203D, H208Y, R211K, A272P, T286A, I293V  
>CA84124| codons 1-301
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALMEICTELEEEGKISKIGPENPYNTPV
FAIKKKNSDKWRKLVDFRELNRRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSIPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPEIVI
YQYVDDLYVGSDLEIEQHRTKIDELRQYLWKWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGAKALTEVVPLTEEAE
L

References
Author Title Citation
Rhee, SY HIV-1 protease mutations and protease inhibitor cross resistance. AAC, 2010