<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
547 CS_547 Cote d'Ivoire 2004 HIV1 A Plasma None

Treatment History
Order Regimen Weeks
1 3TC|AZT|D4T|DDI|EFV|NFV 268

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
  G48GR, V82VD I13V, K14R, G16GR, K20I, M36IT, R41K, L63P, H69K, L89M  
>CS_547| codons 1-99
PQITLWQRPLVTVRIRGQLIEALLDTGADDTVLEETNLPGKWKPKMIRGIGGFIKVRQYD
QIPIEICGKKAIGTVLVGPTPDNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
    K103KN K238T K11T, V35T, T39K, K43E, K102KE, K122E, D123ST, I142V, S162H, K173T, Q174K, D177E, I178L, V179VI, I195L, T200A, Q207A, R211K, V245Q, E248D  
>CS_547| codons 1-270
PISPIETVPVTLKPGMDGPKVKQWPLTEEKIKALTEICKEMEEEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKENKSVTVLDVGDAYFSVPL
DETFRKYTAFTIPSINNETPGVRYQYNVLPQGWKGSPAIFQHSMTKILEPFRTKNPELII
YQYMDDLYVGSDLELGQHRAKIEELRAHLLKWGFTTPDKKHQKEPPFLWMGYELHPDTWT
VQPIQLPDKDSWTVNDIQKLVGKLNWASQI

References
Author Title Citation
Seyler, C Impact of genotypic drug resistance mutations on clinical and immunological outcomes in HIV-infected adults on HAART in West Africa. AIDS, 2007