<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
545 CS_545 Cote d'Ivoire 2004 HIV1 CRF02_AG Plasma None

Treatment History
Order Regimen Weeks
1 3TC|AZT|D4T|DDI|IDV 170

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67DN, K70KR, M184V       V35T, E36D, K122E, S134SR, I135V, V148VG, S162A, K173T, Q174K, D177E, I178M, L193F, T200A, Q207E, R211K, V245Q  
>CS_545| codons 1-249
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTDICTEMEKEGKISKIGPENPYNTPV
FAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPRVNNETPGIRYQYNGLPQGWKGSPAIFQASMTKILEPFRTKNPEMVI
YQYVDDLYVGSDFEIGQHRAKIEELREHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPEK

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I84V L33I, L89V L10I, I13V, K14R, L19P, K20I, A22V, M36I, N37D, L38I, R41K, L63P, H69K, A71V, T74S  
>CS_545| codons 1-99
PQITLWQRPIVTVRIGGQPIEVLLDTGADDTVIEEIDIPGKWKPKMIGGIGGFIKVRQYD
QIPIEICGKKVIGSVLVGPTPVNVIGRNVLTQIGCTLNF

References
Author Title Citation
Seyler, C Impact of genotypic drug resistance mutations on clinical and immunological outcomes in HIV-infected adults on HAART in West Africa. AIDS, 2007